{"product_id":"proteintech-10528-1-ap","title":"Proteintech, 10528-1-AP, DDX21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX21 (10528-1-AP) by Proteintech is a Polyclonal antibody targeting DDX21 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n10528-1-AP targets DDX21 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, chIP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  Jurkat cells,  PC-3 cells,  HepG2 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa. Catalog# 10528-1-AP is a rabbit polyclonal antibody raised against N-terminal of human DDX21.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0804 Product name: Recombinant human DDX21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC008071 Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 87 kDa\nGenBank Accession Number: BC008071\nGene Symbol: DDX21\nGene ID (NCBI): 9188\nRRID: AB_2092705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NR30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848476329,"sku":"10528-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10528-1-ap","provider":"Iright","version":"1.0","type":"link"}