{"product_id":"proteintech-10529-1-ap","title":"Proteintech, 10529-1-AP, Chromogranin A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Chromogranin A (10529-1-AP) by Proteintech is a Polyclonal antibody targeting Chromogranin A in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n10529-1-AP targets Chromogranin A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, mouse adrenal gland tissue,  SH-SY5Y cells,  rat adrenal gland tissue\nPositive IHC detected in: human lung cancer tissue, human colon tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue, mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Predict reactive species\nFull Name: chromogranin A (parathyroid secretory protein 1)\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 70-85 kDa\nGenBank Accession Number: BC006459\nGene Symbol: Chromogranin A\nGene ID (NCBI): 1113\nRRID: AB_2081122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10645\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870889641,"sku":"10529-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10529-1-ap","provider":"Iright","version":"1.0","type":"link"}