{"product_id":"proteintech-10531-1-ap","title":"Proteintech, 10531-1-AP, DAD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DAD1 (10531-1-AP) by Proteintech is a Polyclonal antibody targeting DAD1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n10531-1-AP targets DAD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDAD1 (defender against cell death 1) is a downstream target of the NFkB survival pathway and exhibits an antiapoptotic function. It is also named as OST2 (Oligosaccharyl transferase2) and catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser\/Thr consensus motif in nascent polypeptide chains. Increased expression of DAD1 has been observed in various tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0814 Product name: Recombinant human DAD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC007403 Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG Predict reactive species\nFull Name: defender against cell death 1\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC007403\nGene Symbol: DAD1\nGene ID (NCBI): 1603\nRRID: AB_2089878\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61803\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869671837865,"sku":"10531-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10531-1-ap","provider":"Iright","version":"1.0","type":"link"}