{"product_id":"proteintech-10533-1-ap","title":"Proteintech, 10533-1-AP, IL-21R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-21R (10533-1-AP) by Proteintech is a Polyclonal antibody targeting IL-21R in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10533-1-AP targets IL-21R in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, K-562 cells,  mouse thymus tissue,  Raji cells,  rat thymus tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL21R, a receptor for interleukin-21, belongs to the type I cytokine receptor family. IL21R has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0762 Product name: Recombinant human IL-21R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-538 aa of BC004348 Sequence: LLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS Predict reactive species\nFull Name: interleukin 21 receptor\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC004348\nGene Symbol: IL-21R\nGene ID (NCBI): 50615\nRRID: AB_2124107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869467103401,"sku":"10533-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10533-1-ap","provider":"Iright","version":"1.0","type":"link"}