{"product_id":"proteintech-10540-1-ap","title":"Proteintech, 10540-1-AP, GTF2A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF2A2 (10540-1-AP) by Proteintech is a Polyclonal antibody targeting GTF2A2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10540-1-AP targets GTF2A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  HeLa cells\nPositive IHC detected in: mouse liver tissue, mouse heart tissue,  rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscription mediated by RNA polymerase II depends on a set of different transcription factors to form the pre-initiation complex. TFIIA is involved in the construction of this complex and increases the affinity of TBP for the DNA union region [PMID:20480367]. TFIIA in a complex with TBP mediates transcriptional activity [PMID: 11030333]. GTF2A2 is one subunit of TFIIA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0825 Product name: Recombinant human GTF2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC001919 Sequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE Predict reactive species\nFull Name: general transcription factor IIA, 2, 12kDa\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC001919\nGene Symbol: GTF2A2\nGene ID (NCBI): 2958\nRRID: AB_2114351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52657\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887660978345,"sku":"10540-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10540-1-ap","provider":"Iright","version":"1.0","type":"link"}