{"product_id":"proteintech-10541-1-ap","title":"Proteintech, 10541-1-AP, Calmodulin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calmodulin (10541-1-AP) by Proteintech is a Polyclonal antibody targeting Calmodulin in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10541-1-AP targets Calmodulin in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, HepG2 cells,  mouse brain tissue,  MCF-7 cells,  HeLa cells,  NCCIT cells,  rat skeletal muscle tissue\nPositive IP detected in: Ramos cells\nPositive IHC detected in: human breast cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalmodulin (CaM) is a Ca(2+)-binding protein that transduces Ca2+-mediated signals by binding to and regulating the activity of hundreds of enzymes and non-enzymatic proteins. It is highly conserved across species and involved in many biological processes, including vesicle release, cell proliferation, and apoptosis. This antibody can recognize CALM1, CALM2 and CALM3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0827 Product name: Recombinant human CALM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC006182 Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDESLSMPLISSFCPRLFHPCLPRPDAFIS Predict reactive species\nFull Name: calmodulin 3 (phosphorylase kinase, delta)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC006182\nGene Symbol: Calmodulin 3\nGene ID (NCBI): 808\nRRID: AB_2069442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881146025,"sku":"10541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10541-1-ap","provider":"Iright","version":"1.0","type":"link"}