{"product_id":"proteintech-10572-1-ap","title":"Proteintech, 10572-1-AP, MPZ \/ P0 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPZ \/ P0 (10572-1-AP) by Proteintech is a Polyclonal antibody targeting MPZ \/ P0 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10572-1-AP targets MPZ \/ P0 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue,  rat brain tissue\nPositive IHC detected in: rat Ischiadic nerve tissue, mouse Ischiadic nerve tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPZ (myelin protein zero), also known as P0, is a transmembrane glycoprotein that belongs to the immunoglobulin supergene family. Synthesized by myelin-forming Schwann cells, MPZ is the major structural protein component of myelin in the peripheral nervous system. It is involved in the formation and maintenance of compact myelin and plays a role in the creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. More than 120 mutations detected in the gene of MPZ cause various forms of hereditary neuropathy, which include Charcot-Marie-Tooth disease type 1B (CMT1B), CMT2, Dejerine-Sottas syndrome (DSS), and congenital hypomyelination neuropathy (CHN). This antibody can recognize endogenous MPZ and can be used as a marker of myelinating Schwann cells. MPZ can be detected the 25-30 kDa band by western blot. A band of 36 kDa could also be detected, which is a novel isoform of MPZ that contains an additional domain at the C-terminal (PMID: 22457349). It can also exist as a dimer (PMID: 12933931).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, frog\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0848 Product name: Recombinant human MPZ,P0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC006491 Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK Predict reactive species\nFull Name: myelin protein zero\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC006491\nGene Symbol: MPZ\nGene ID (NCBI): 4359\nRRID: AB_2144657\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25189\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879671465,"sku":"10572-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10572-1-ap","provider":"Iright","version":"1.0","type":"link"}