{"product_id":"proteintech-10575-1-ap","title":"Proteintech, 10575-1-AP, PEBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEBP1 (10575-1-AP) by Proteintech is a Polyclonal antibody targeting PEBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10575-1-AP targets PEBP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  mouse liver tissue,  mouse testis tissue\nPositive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRaf kinase inhibitor protein (RKIP), also termed phosphatidylethanolamine binding protein PEBP1, was initially identified as a potent inhibitor of Raf-1\/MEK\/ERK, NF-kB, and G-protein-coupled receptor signaling pathways. Later RKIP has been further identified as a metastasis suppressor and its loss of expression has been reported in various cancers. Its expression has been proposed as a prognostic marker for patients diagnosed with the above cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0864 Product name: Recombinant human PEBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-187 aa of BC008714 Sequence: EWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK Predict reactive species\nFull Name: phosphatidylethanolamine binding protein 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC008714\nGene Symbol: PEBP1\nGene ID (NCBI): 5037\nRRID: AB_2299521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30086\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869422080169,"sku":"10575-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10575-1-ap","provider":"Iright","version":"1.0","type":"link"}