{"product_id":"proteintech-10592-1-ap","title":"Proteintech, 10592-1-AP, DLX5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLX5 (10592-1-AP) by Proteintech is a Polyclonal antibody targeting DLX5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10592-1-AP targets DLX5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, A375 cells,  U-251 cells\nPositive IHC detected in: human thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLX5 belongs to the DLX family of homeobox transcription factors (Dlx1, Dlx2, Dlx5 and Dlx6), which is expressed in overlapping domains at different stages of cell differentiation in the subpallium and controls differentiation of GABAergic neurons. DLX5 is an immediate early BMP-responsive transcriptional activator that essential for osteoblast differentiation. It can bind to and stimulate the homeodomain-response element of the ALPL and SP7 promoter. DLX5 can form homodimer with DLX2(~34kd) and heterodimer with MSX2(~29kd).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0910 Product name: Recombinant human DLX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC006226 Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY Predict reactive species\nFull Name: distal-less homeobox 5\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC006226\nGene Symbol: DLX5\nGene ID (NCBI): 1749\nRRID: AB_2090724\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56178\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940259497,"sku":"10592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10592-1-ap","provider":"Iright","version":"1.0","type":"link"}