{"product_id":"proteintech-10611-2-ap","title":"Proteintech, 10611-2-AP, COX10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX10 (10611-2-AP) by Proteintech is a Polyclonal antibody targeting COX10 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10611-2-AP targets COX10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain located in the mitochondrial inner membrane. It catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is predicted to contain 7-9 transmembrane domains, and it is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. In addition, COX10 may play a certain role in the development and progression of azoospermia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0930 Product name: Recombinant human COX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006394 Sequence: MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILAQLSKIKLTALVVSTTAAGFALAPGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW Predict reactive species\nFull Name: COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast)\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC006394\nGene Symbol: COX10\nGene ID (NCBI): 1352\nRRID: AB_2084833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12887\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932788393,"sku":"10611-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10611-2-ap","provider":"Iright","version":"1.0","type":"link"}