{"product_id":"proteintech-10632-1-ap","title":"Proteintech, 10632-1-AP, RHOC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOC (10632-1-AP) by Proteintech is a Polyclonal antibody targeting RHOC in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10632-1-AP targets RHOC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NIH\/3T3 cells,  C6 cells,  HeLa cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRas homolog family member C (RHOC) encodes a Rho-related GTP-binding protein, which belongs to small GTPase superfamily and also Rho family. RHOC. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Expression of RHOC contributes to metastatic phenotype of melanoma cells and is associated with multiple cancers including gastric carcinomas, ovarian carcinomas and breast cancer as well.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0988 Product name: Recombinant human RHOC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC007245 Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL Predict reactive species\nFull Name: ras homolog gene family, member C\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC007245\nGene Symbol: RHOC\nGene ID (NCBI): 389\nRRID: AB_10898358\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08134\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882849961,"sku":"10632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10632-1-ap","provider":"Iright","version":"1.0","type":"link"}