{"product_id":"proteintech-10641-1-ap","title":"Proteintech, 10641-1-AP, TDP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TDP1 (10641-1-AP) by Proteintech is a Polyclonal antibody targeting TDP1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n10641-1-AP targets TDP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTyrosyl DNA phosphodiesterase 1 (TDP1) is an enzyme capable of hydrolyzing phosphodiester bonds between tyrosine and the 3-phosphate of DNA, which are typically generated in a transient manner by DNA topoisomerase I (topo I) and it appears to be more mobile and diffusible than topo I, and it has a different distribution in the nucleus (PMID:15494395). TDP1 is involed in protecting cells against oxidative DNA damage, and with the impaired ability of TDP1-deficient cells to remove 3-phosphoglycolate (PMID:21041670). Defects in TDP1 are the cause of spinocerebellar ataxia autosomal recessive with axonal neuropathy (SCAN1)(PMID:17948061).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0964 Product name: Recombinant human TDP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC006083 Sequence: MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGTHL Predict reactive species\nFull Name: tyrosyl-DNA phosphodiesterase 1\nCalculated Molecular Weight: 34 kDa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC006083\nGene Symbol: TDP1\nGene ID (NCBI): 55775\nRRID: AB_2240520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869436170409,"sku":"10641-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10641-1-ap","provider":"Iright","version":"1.0","type":"link"}