{"product_id":"proteintech-10666-1-ap","title":"Proteintech, 10666-1-AP, PMM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PMM2 (10666-1-AP) by Proteintech is a Polyclonal antibody targeting PMM2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10666-1-AP targets PMM2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  multi-tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPMM2(Phosphomannomutase 2) belongs to the eukaryotic PMM family. It is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. PMM2 catalyzes the second step in the conversion of fructose-6P to GDP-mannose.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1031 Product name: Recombinant human PMM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC008310 Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS Predict reactive species\nFull Name: phosphomannomutase 2\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC008310\nGene Symbol: PMM2\nGene ID (NCBI): 5373\nRRID: AB_2166973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15305\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913815721,"sku":"10666-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10666-1-ap","provider":"Iright","version":"1.0","type":"link"}