{"product_id":"proteintech-10688-1-ap","title":"Proteintech, 10688-1-AP, STRADB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STRADB (10688-1-AP) by Proteintech is a Polyclonal antibody targeting STRADB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10688-1-AP targets STRADB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells,  mouse heart tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe 418 amino acid STRADB protein, which is also named as ALS2CR2 and ILPIP, contains a putative N-terminal ATP-binding site, a protein kinase domain, and several C-terminal phosphorylation sites. STRADB potentiates the antiapoptotic activity of XIAP by enhancing XIAP-mediated activation of JNK1 and other JNK family members, but not by modulating XIAP-mediated caspase inhibition. This protein has 3 isoforms produced by alternative splicing with the MW of 47 kDa, 42 kDa and 31 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1040 Product name: Recombinant human STRADB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-418 aa of BC008302 Sequence: ITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF Predict reactive species\nFull Name: STE20-related kinase adaptor beta\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 28-31 kDa, 38-42 kDa\nGenBank Accession Number: BC008302\nGene Symbol: STRADB\nGene ID (NCBI): 55437\nRRID: AB_2197715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0K7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887818592425,"sku":"10688-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10688-1-ap","provider":"Iright","version":"1.0","type":"link"}