{"product_id":"proteintech-10708-1-ap","title":"Proteintech, 10708-1-AP, SAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAT1 (10708-1-AP) by Proteintech is a Polyclonal antibody targeting SAT1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10708-1-AP targets SAT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSpermidine\/spermine N1-acetyltransferase 1 (SAT1 or SSAT1) is the key regulatory enzyme in the catabolism of polyamines, catalyzing acetylation of spermidine or spermine to generate N1-acetyl spermidine or N1-acetyl spermine, and N1, N12-diacetylspermine. The cellular level of SAT1 is normally extremely low, but it is induced rapidly by a variety of stimuli, including polyamines, polyamine analogs, toxic chemicals, certain drugs, and growth factors. Downregulation of SAT1 has been reported in Epstein-Barr virus positive Burkitt's lymphoma cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1154 Product name: Recombinant human SAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008424 Sequence: MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE Predict reactive species\nFull Name: spermidine\/spermine N1-acetyltransferase 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 15-25 kDa\nGenBank Accession Number: BC008424\nGene Symbol: SAT1\nGene ID (NCBI): 6303\nRRID: AB_2877739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21673\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855816361,"sku":"10708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10708-1-ap","provider":"Iright","version":"1.0","type":"link"}