{"product_id":"proteintech-10711-1-ap","title":"Proteintech, 10711-1-AP, C1D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1D (10711-1-AP) by Proteintech is a Polyclonal antibody targeting C1D in WB, IP, IHC, ELISA applications with reactivity to human samples\n10711-1-AP targets C1D in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells\nPositive IP detected in: DU 145 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1121 Product name: Recombinant human C1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC005235 Sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS Predict reactive species\nFull Name: C1D nuclear receptor co-repressor\nCalculated Molecular Weight: 16 kDa\nGenBank Accession Number: BC005235\nGene Symbol: C1D\nGene ID (NCBI): 10438\nRRID: AB_2067014\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13901\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869645983913,"sku":"10711-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10711-1-ap","provider":"Iright","version":"1.0","type":"link"}