{"product_id":"proteintech-10720-1-ap","title":"Proteintech, 10720-1-AP, Cyclophilin A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclophilin A (10720-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclophilin A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n10720-1-AP targets Cyclophilin A in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, C6 cells,  Raji cells,  HepG2 cells,  K-562 cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissue, human placenta tissue,  human tonsillitis tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1120 Product name: Recombinant human CYPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC005320 Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE Predict reactive species\nFull Name: peptidylprolyl isomerase A (cyclophilin A)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC005320\nGene Symbol: PPIA\nGene ID (NCBI): 5478\nRRID: AB_2237516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62937\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855062697,"sku":"10720-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10720-1-ap","provider":"Iright","version":"1.0","type":"link"}