{"product_id":"proteintech-10766-1-ap","title":"Proteintech, 10766-1-AP, PRG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRG2 (10766-1-AP) by Proteintech is a Polyclonal antibody targeting PRG2 in IHC, ELISA applications with reactivity to human samples\n10766-1-AP targets PRG2 in IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRG2, also known as BMPG, has 222 amino acid residues with a 16 N-terminal signal sequence, so the mature form has 206 amino acid residues. High levels of PRG2 are present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein can be cleaved into eosinophil granule major basic protein (MBP), which is the major constituent of the crystalline core of the eosinophil granule. MBP is highly basic and toxic to both mammalian cells and parasites, and it functions in the defense against invading parasites (PMID: 21270431).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1150 Product name: Recombinant human PRG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC005929 Sequence: MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY Predict reactive species\nFull Name: proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: BC005929\nGene Symbol: PRG2\nGene ID (NCBI): 5553\nRRID: AB_2169223\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13727\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869577236649,"sku":"10766-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10766-1-ap","provider":"Iright","version":"1.0","type":"link"}