{"product_id":"proteintech-10778-1-ap","title":"Proteintech, 10778-1-AP, Adrenomedullin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Adrenomedullin (10778-1-AP) by Proteintech is a Polyclonal antibody targeting Adrenomedullin in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10778-1-AP targets Adrenomedullin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissue, human pancreas cancer tissue,  human kidney tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdrenomedullin (AM) and proadrenomedullin N-terminal 20 peptide (PAMP) are two small active hormones derived from the expression of a single gene (Adm) that is expressed throughout the GI tract, including the mucosal epithelium, glandular duct cells, neuroendocrine cells, and smooth muscle cells of the GI tract, between the oral cavity and the rectum (PMID:10782362, PMID:27345325). These two peptides coexist in GI cells, where they regulate many physiological functions including vasodilation, angiogenesis, anti-inflammation, organ protection, and tissue repair. AM suppresses inflammatory cytokine production in the intestinal mucosa, improves vascular and lymphatic function, mucosal epithelial repair, and intestinal barrier function in animal models with intestinal inflammation (PMID:27965594, PMID:29311984). Molecular mass species of 18, 14, and 6 kDa were identified in tumor cell lysates and presumably represent AM precursor, processed intermediates, and the authentic peptide, respectively. There is also a 22-kDa immunoreactive species in two cancer cell lines, H720 and MCF-7 (PMID: 8798536).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1197 Product name: Recombinant human ADM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC015961 Sequence: MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL Predict reactive species\nFull Name: adrenomedullin\nCalculated Molecular Weight: 20 kDa\nGenBank Accession Number: BC015961\nGene Symbol: Adrenomedullin\/ADM\nGene ID (NCBI): 133\nRRID: AB_2242255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938588329,"sku":"10778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10778-1-ap","provider":"Iright","version":"1.0","type":"link"}