{"product_id":"proteintech-10795-1-ap","title":"Proteintech, 10795-1-AP, Sestrin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Sestrin 2 (10795-1-AP) by Proteintech is a Polyclonal antibody targeting Sestrin 2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n10795-1-AP targets Sestrin 2 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human brain tissue,  human liver tissue,  NIH\/3T3 cells,  rat liver tissue,  K-562 cells,  mouse kidney tissue,  A2780 cells,  RAW 264.7 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791). Sesn2 encodes a 480 amino acid protein which can run as a 60 kDa band on SDS-polyacrylamide gel electrophoresis(PMID:20878915).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1247 Product name: Recombinant human Sestrin2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT Predict reactive species\nFull Name: sestrin 2\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC013304\nGene Symbol: SESN2\/Sestrin 2\nGene ID (NCBI): 83667\nRRID: AB_2185480\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823179433,"sku":"10795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10795-1-ap","provider":"Iright","version":"1.0","type":"link"}