{"product_id":"proteintech-10805-1-ap","title":"Proteintech, 10805-1-AP, EEF1E1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EEF1E1 (10805-1-AP) by Proteintech is a Polyclonal antibody targeting EEF1E1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10805-1-AP targets EEF1E1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human testis tissue,  Jurkat cells,  HepG2 cells,  SKOV-3 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDuring the translation processes, aminoacyl-tRNA synthetases (ARSs) ligate specific amino acids to tRNAs. Together with non-enzymatic proteins called ARS-interacting multifunctional proteins (AIMPs), the ARSs form a macromolecular complex [PMID:15286174]. This complex has an essential role in protein synthesis, but also in other biological processes including angiogenesis, apoptosis, and inflammation. [PMID:21789020] AIMP3 is not only associated with the multi-tRNA synthetase complex via its specific interaction with methionyl-tRNA synthetase, but also works as a tumor suppressor by interacting with ATM, the upstream kinase of p53 [PMID:18343821].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1092 Product name: Recombinant human EEF1E1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-174 aa of BC005291 Sequence: MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH Predict reactive species\nFull Name: eukaryotic translation elongation factor 1 epsilon 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC005291\nGene Symbol: EEF1E1\nGene ID (NCBI): 9521\nRRID: AB_2097140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43324\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869404221609,"sku":"10805-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10805-1-ap","provider":"Iright","version":"1.0","type":"link"}