{"product_id":"proteintech-10812-1-ap","title":"Proteintech, 10812-1-AP, Kallikrein 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kallikrein 2 (10812-1-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 2 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n10812-1-AP targets Kallikrein 2 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK2(Kallikrein-2) is also named as hGK-1 and belongs to the Kallikrein subfamily. It plays a role in prostate cancer susceptibility and this role may be realized at least in part by the induction of increases in its production. It also may mediate tumor growth and invasion by participating in proteolytic cascades. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 29 kDa, 25 kDa, 18 kDa and 17 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1077 Product name: Recombinant human KLK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC005196 Sequence: MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP Predict reactive species\nFull Name: kallikrein-related peptidase 2\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 29 kda\nGenBank Accession Number: BC005196\nGene Symbol: KLK2\nGene ID (NCBI): 3817\nRRID: AB_2134232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869552791721,"sku":"10812-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10812-1-ap","provider":"Iright","version":"1.0","type":"link"}