{"product_id":"proteintech-10818-1-ap","title":"Proteintech, 10818-1-AP, ERCC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERCC2 (10818-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC2 in WB, IP, IHC, ELISA applications with reactivity to human samples\n10818-1-AP targets ERCC2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human lymphoma tissue,  human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nExcision-repair complementing defective in Chinese hamster 2(ERCC2), belongs to the nucleotide excision repair pathway, is a component of the TFIIH transcription complex and required for the association of the CDK-activating kinase(CAK) subcomplex with TFIIH. Since TFIIH is involved in both DNA repair and cell cycle progression, ERCC2 is implicated to play an integral role in the nucleotide excision repair pathway. Also it involves in the regulation of vitamin-D receptor activity. As a part of the mitotic spindle-associated MMXD complex, ERCC2 has a role in chromosome segregation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1038 Product name: Recombinant human ERCC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC008346 Sequence: MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRT Predict reactive species\nFull Name: excision repair cross-complementing rodent repair deficiency, complementation group 2\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC008346\nGene Symbol: ERCC2\nGene ID (NCBI): 2068\nRRID: AB_2231330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18074\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868896940201,"sku":"10818-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10818-1-ap","provider":"Iright","version":"1.0","type":"link"}