{"product_id":"proteintech-10831-1-ap","title":"Proteintech, 10831-1-AP, ICAM-1\/CD54 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ICAM-1\/CD54 (10831-1-AP) by Proteintech is a Polyclonal antibody targeting ICAM-1\/CD54 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples\n10831-1-AP targets ICAM-1\/CD54 in WB, IHC, IF-P, IP, CoIP, ChIP, ELISA, Blocking applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, Raji cells,  L02 cells\nPositive IP detected in: Raji cells\nPositive IHC detected in: human tonsillitis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhere is ICAM-1 expressed?Intercellular Adhesion Molecule 1 (ICAM-1), also known as Cluster of Differentiation 54 (CD54) is a transmembrane glycoprotein constitutively expressed at low levels in endothelial cells, pericytes and on some lymphocytes and monocytes1. It is located at the cytoplasmic membrane, with a large extracellular region of mainly hydrophobic amino acids joined to a small transmembrane region and a cytoplasmic tail. It has a molecular weight of 75 to 115 kDa depending on the level of glycosylation.What is the function of ICAM-1?ICAM-1 is important in both innate and adaptive immune responses as an adhesion molecule. Although it is constitutively expressed, in the presence of pro-inflammatory cytokines such as TNFα the endothelial cells are activated and upregulate expression of ICAM-12. In blood vessels lined with endothelial cells, leukocytes that are rolling over the surface are able to bind to ICAM-1 and transmigrate through the endothelial barrier and into the tissue. The initial binding of the leukocytes to ICAM-1 causes a Ca2+ release that initiates endothelial cell contraction and weakening of the intercellular tight junctions3, 4. This protein can be used as an indicator of endothelial activation and of vascular inflammation.What is the role of ICAM-1 in disease?Beyond the role in the immune response, ICAM-1 has also been identified as the target of attachment for the human rhinovirus, the cause of the common cold. Binding of the virus to ICAM-1 causes the viral capsid to uncoat and leads to release of the genetic material5.Hubbard, A. K. \u0026amp; Rothlein, R. Intercellular adhesion molecule-1 (ICAM-1) expression and cell signaling cascades.Free Radic. Biol. Med.28,1379-86 (2000).Long, E. O. ICAM-1: getting a grip on leukocyte adhesion.J. Immunol.186,5021-3 (2011).Lawson, C. \u0026amp; Wolf, S. ICAM-1 signaling in endothelial cells. (2009).Lyck, R. \u0026amp; Enzmann, G. The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues.Curr. Opin. Hematol.22,53-59 (2015).Xing, L., Casasnovas, J. M. \u0026amp; Cheng, R. H. Structural analysis of human rhinovirus complexed with ICAM-1 reveals the dynamics of receptor-mediated virus uncoating.J. Virol.77,6101-7 (2003).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1188 Product name: Recombinant human ICAM-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-532 aa of BC015969 Sequence: GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP Predict reactive species\nFull Name: intercellular adhesion molecule 1\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC015969\nGene Symbol: ICAM-1\nGene ID (NCBI): 3383\nENSEMBL Gene ID: ENSG00000090339\nRRID: AB_2264494\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05362\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823769257,"sku":"10831-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10831-1-ap","provider":"Iright","version":"1.0","type":"link"}