{"product_id":"proteintech-10840-1-ap","title":"Proteintech, 10840-1-AP, RAP1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAP1B (10840-1-AP) by Proteintech is a Polyclonal antibody targeting RAP1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10840-1-AP targets RAP1B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue,  A549 cells,  C6 cells,  A431 cells,  human brain tissue,  HepG2 cells,  mouse kidney tissue,  NIH\/3T3 cells\nPositive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAP1B is a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. RAP1B localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. It also plays a role in regulating outside-in signaling in platelets.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1282 Product name: Recombinant human RAP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC000176 Sequence: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL Predict reactive species\nFull Name: RAP1B, member of RAS oncogene family\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC000176\nGene Symbol: RAP1B\nGene ID (NCBI): 5908\nRRID: AB_2253539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877213865,"sku":"10840-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10840-1-ap","provider":"Iright","version":"1.0","type":"link"}