{"product_id":"proteintech-10842-1-ap","title":"Proteintech, 10842-1-AP, Alpha Synuclein Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha Synuclein (10842-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Synuclein in WB, IHC, IF\/ICC, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n10842-1-AP targets Alpha Synuclein in WB, IHC, IF\/ICC, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, human kidney tissue,  human placenta tissue,  human testis tissue,  human skin tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: rat brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. Α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, yeast, zebra finch\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1285 Product name: Recombinant human a-Synuclein protein Source: e coli. -derived, PKG Tag: GST Domain: 1-140 aa of BC013293 Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Predict reactive species\nFull Name: synuclein, alpha (non A4 component of amyloid precursor)\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 15-19 kDa\nGenBank Accession Number: BC013293\nGene Symbol: Alpha Synuclein\nGene ID (NCBI): 6622\nRRID: AB_2192672\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P37840\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868831928489,"sku":"10842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10842-1-ap","provider":"Iright","version":"1.0","type":"link"}