{"product_id":"proteintech-10862-1-ap","title":"Proteintech, 10862-1-AP, Endoglin\/CD105 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Endoglin\/CD105 (10862-1-AP) by Proteintech is a Polyclonal antibody targeting Endoglin\/CD105 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n10862-1-AP targets Endoglin\/CD105 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HeLa cells,  human placenta tissue,  mouse lung tissue,  rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human breast cancer tissue, human liver cancer tissue,  human lung cancer tissue,  human placenta tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndoglin (ENG, CD105) is a homodimeric cell membrane glycoprotein of 180 kDa, composed of disulphide-linked subunits of 90-95 kDa. Endoglin is a proliferation-associated and hypoxia-inducible protein mainly expressed on vascular endothelial cells. It acts as an accessory receptor for transforming growth factor beta (TFG-β) and is involved in vascular development and remodelling. The important role of Endoglin in angiogenesis and in tumor progression makes it an ideal target for antiangiogenic therapy and a good marker for tumor prognosis. (PMID: 1326540; 14528280; 21737653; 12773481)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1287 Product name: Recombinant human Endoglin\/CD105 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-658 aa of BC014271 Sequence: GGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA Predict reactive species\nFull Name: endoglin\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 75-90 kDa, 170-180 kDa\nGenBank Accession Number: BC014271\nGene Symbol: CD105\nGene ID (NCBI): 2022\nRRID: AB_2098906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17813\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839792809,"sku":"10862-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10862-1-ap","provider":"Iright","version":"1.0","type":"link"}