{"product_id":"proteintech-10883-1-ap","title":"Proteintech, 10883-1-AP, CDKN2A\/P16-INK4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDKN2A\/P16-INK4A (10883-1-AP) by Proteintech is a Polyclonal antibody targeting CDKN2A\/P16-INK4A in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n10883-1-AP targets CDKN2A\/P16-INK4A in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HEK293 cells,  HeLa cells,  HepG2 cells,  PC-3 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MDCK cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBackgroundp16 is an important cell cycle regulator and acts as a tumor suppressor. It may also be referred to as one of a number of synonyms, including p16INK4a and cyclin-dependent kinase inhibitor 2A.What is the molecular weight of P16?16kDa. P16 is encoded by the CDKN2A gene in humans and is a chain comprising 148 amino acids.What is the function of p16?P16 inhibits cells from progressing from G1 into S phase, binding to cyclin-dependent kinase 4 (CDK4) and inhibiting its kinase ability, so that it cannot phosphorylate the retinoblastoma tumor suppressor (RB). Without this phosphorylation, RB does not activate downstream genes, so the G1\/S checkpoint cannot be passed and the cell does not proliferate (PMID: 8259215).What is the role of p16 in senescence?In senescence, cells are irreversibly arrested in the cell cycle. P16 is expressed more highly in aging tissue, is associated with intrinsic cellular aging signals such as telomere shortening, and can therefore be used as a marker of senescence (PMID: 9244355; PMID: 19535234). Due to its role in cell cycle arrest, p16 drives the initiation and maintenance of a cellular senescent phenotype.What is the role of p16 in cancer?As a negative regulator of proliferation, p16 is a known tumor suppressor. Mutations in the CDKN2A gene that lead to inactivation of p16 protein have been associated with an increased risk of cancer and are often observed in primary tumors and in cancer cell lines (PMID: 9508208). The inactivation of p16 has been shown to be a key early stage of tumor progression. In a small number of tumor types that are caused by the human papilloma virus (HPV), p16 is in fact overexpressed when RB is inactivated, releasing p16 and causing an accumulation (PMID: 21297668).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, canine, monkey, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species\nFull Name: cyclin-dependent kinase inhibitor 2A\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC021998\nGene Symbol: CDKN2A\nGene ID (NCBI): 1029\nRRID: AB_2078303\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868819771561,"sku":"10883-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10883-1-ap","provider":"Iright","version":"1.0","type":"link"}