{"product_id":"proteintech-10891-2-ap","title":"Proteintech, 10891-2-AP, PLDN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLDN (10891-2-AP) by Proteintech is a Polyclonal antibody targeting PLDN in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10891-2-AP targets PLDN in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion. Pallidin is a 25 kDa subunit of the octamer BLOC-1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1337 Product name: Recombinant human PLDN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC004819 Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM Predict reactive species\nFull Name: pallidin homolog (mouse)\nCalculated Molecular Weight: 23~24 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC004819\nGene Symbol: PLDN\nGene ID (NCBI): 26258\nRRID: AB_2164174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UL45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868877050025,"sku":"10891-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10891-2-ap","provider":"Iright","version":"1.0","type":"link"}