{"product_id":"proteintech-10948-2-ap","title":"Proteintech, 10948-2-AP, SUB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUB1 (10948-2-AP) by Proteintech is a Polyclonal antibody targeting SUB1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10948-2-AP targets SUB1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUB1 gene encodes activated RNA polymerase II transcriptional coactivator p15, also termed as positive cofactor 4 (PC4) or p14. SUB1 is a sort of general coactivator that functions in assembling and stablization of transcription complex. It has DNA binding activity and is localized in the nucleus, mulitple modification sites of phosphorylation or acetylation may turn it appear slightly shifted molecular weight. Catalog#10948-2-AP is a rabbit polyclonal antibody raised against full-length human SUB1. This antibody recognize 14-16 kDa (P14 or P15), 20 kDa(phospho form) and 30 kDa (Dimer form).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1390 Product name: Recombinant human SUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC009610 Sequence: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL Predict reactive species\nFull Name: SUB1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 18-23 kDa\nGenBank Accession Number: BC009610\nGene Symbol: SUB1\nGene ID (NCBI): 10923\nRRID: AB_2255452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53999\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869386428585,"sku":"10948-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10948-2-ap","provider":"Iright","version":"1.0","type":"link"}