{"product_id":"proteintech-10959-1-ap","title":"Proteintech, 10959-1-AP, PSMG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMG2 (10959-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG2 in WB, ELISA applications with reactivity to human samples\n10959-1-AP targets PSMG2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProteasome assembly chaperone 2 (PSMG2), also named as Hepatocellular carcinoma-susceptibility protein 3, Tumor necrosis \n\nfactor superfamily member 5-induced protein 1. It has a function as a chaperone protein which promotes assembly of the 20S \n\nproteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome \n\nsubunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring \n\ndimerization.It is widely expressed with highest levels in lung, brain and colon,moderately expressed in muscle, stomach, \n\nspleen and heart and weakly expressed in small intestine, pancreas and liver,highly expressed in hepatocellular carcinomas \n\nwith low levels in surrounding liver tissue. Molecular mass of PSMG2 is 29kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1400 Product name: Recombinant human PSMG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC013356 Sequence: MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF Predict reactive species\nFull Name: proteasome (prosome, macropain) assembly chaperone 2\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC013356\nGene Symbol: PSMG2\nGene ID (NCBI): 56984\nRRID: AB_2171454\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969U7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776387241,"sku":"10959-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10959-1-ap","provider":"Iright","version":"1.0","type":"link"}