{"product_id":"proteintech-10965-1-ap","title":"Proteintech, 10965-1-AP, DCUN1D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCUN1D1 (10965-1-AP) by Proteintech is a Polyclonal antibody targeting DCUN1D1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10965-1-AP targets DCUN1D1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIt has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Those results suggest that DCUN1D1 may play a role in the brain parenchyma invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1440 Product name: Recombinant human DCUN1D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-259 aa of BC009478 Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV Predict reactive species\nFull Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC009478\nGene Symbol: DCUN1D1\nGene ID (NCBI): 54165\nRRID: AB_2088355\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GG9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869456224425,"sku":"10965-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10965-1-ap","provider":"Iright","version":"1.0","type":"link"}