{"product_id":"proteintech-10968-1-ap","title":"Proteintech, 10968-1-AP, NCOA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCOA4 (10968-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA4 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10968-1-AP targets NCOA4 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear receptor coactivator 4 (NCOA4) also named androgen receptor (AR) coactivator ARA70, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret\/PTC3 by an intrachromosomal inversion of chromosome 10 in vivo.  ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. However, PPARg-ARA70 transactivation can be squelched by AR, which suggests cross talk between PPARg- and AR-mediated response. ARA70a has no intrinsic transcription activation domain or histone acetyltransferase activity, but it interacts with histone acetyltransferase, p\/CAF, CBP and p300\/CBP-associated factors, and the basal transcription factor TFIIB. The interaction between ARA70 and AR occurs through the ligand-binding domain. The presence of ARA70 can enhance the androgenic activity of 17-b Estradiol (E2) and antiandrogens toward AR. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.There are several isoforms of \n\nZGPAT that are produced as a result of alternative splicing events. ARA70a is widely expressed, and its expression is highest in testis and adipose tissues, whereas ARA70b (The shorter variant, results from an internal 985-bp deletion.) is solely expressed in the testis.This antibody is a rabbit polyclonal antibody raised against the N-400aa of human NCOA4 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1408 Product name: Recombinant human NCOA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-400 aa of BC012736 Sequence: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV Predict reactive species\nFull Name: nuclear receptor coactivator 4\nCalculated Molecular Weight: 70 kDa\nGenBank Accession Number: BC012736\nGene Symbol: NCOA4\nGene ID (NCBI): 8031\nRRID: AB_3669123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970668201,"sku":"10968-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-10968-1-ap","provider":"Iright","version":"1.0","type":"link"}