{"product_id":"proteintech-11005-1-ap","title":"Proteintech, 11005-1-AP, RPL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPL3 (11005-1-AP) by Proteintech is a Polyclonal antibody targeting RPL3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11005-1-AP targets RPL3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, human kidney tissue,  HeLa cells,  Raji cells,  human placenta tissue,  mouse kidney tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRibosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3, also named as TARBP-B and MGC104284, belongs to the ribosomal protein L3P family. This protein is a component of the 60S subunit. It can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. This is a rabbit polyclonal antibody raised against the C terminus of human RPL3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1436 Product name: Recombinant human RPL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 153-403 aa of BC012786 Sequence: MKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAKEEGA Predict reactive species\nFull Name: ribosomal protein L3\nCalculated Molecular Weight: 46\/27 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC012786\nGene Symbol: RPL3\nGene ID (NCBI): 6122\nRRID: AB_2181760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P39023\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894843049,"sku":"11005-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11005-1-ap","provider":"Iright","version":"1.0","type":"link"}