{"product_id":"proteintech-11044-1-ap","title":"Proteintech, 11044-1-AP, SFRS7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRS7 (11044-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11044-1-AP targets SFRS7 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse testis tissue,  rat testis tissue,  HeLa cells,  HepG2 cells,  SKOV-3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS7 is a member of the serine\/arginine (SR) splicing factor family, which mediated the alternative splicing events target the resulting mRNAs for degradation by means of an RNA surveillance pathway called nonsense-mediated mRNA decay. It was found to repress the splicing of MAPT\/Tau exon 10\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1526 Product name: Recombinant human SFRS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC000997 Sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 7, 35kDa\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC000997\nGene Symbol: SFRS7\nGene ID (NCBI): 6432\nRRID: AB_2185229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16629\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921024681,"sku":"11044-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11044-1-ap","provider":"Iright","version":"1.0","type":"link"}