{"product_id":"proteintech-11054-1-ap","title":"Proteintech, 11054-1-AP, GANP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GANP (11054-1-AP) by Proteintech is a Polyclonal antibody targeting GANP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11054-1-AP targets GANP in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  NIH\/3T3 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:10-1:100\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe minichromosome maintenance protein 3 (MCM3) is one of the MCM proteins essential for the initiation of DNA replication. MCM3AP is MCM3 associated protein, and it has phosphorylation-dependent DNA-primase activity, which was up-regulated in antigen immunization induced germinal center. The mutagenesis of a nuclear localization signal of MCM3 affects the binding of this protein with MCM3, suggesting that MCM3AP may also facilitate MCM3 nuclear localization. Besides, MCM3AP is an acetyltransferase cotaining putative acetyl CoA binding motifs conserved within the GCN5-related N-acetyltransferase superfamily.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1486 Product name: Recombinant human GANP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 378-778 aa of BC013285 Sequence: IGHEFSGRFFHDRRERRLGGLASQEPGAIIELFNSVLQFLASVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGAPWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIPWDDLIALCINHKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQKELQLREGRLAIKPFHPSANNFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRFEDQLQQWLSEDSGAFTDLTSLPLYLPQTLVSLSHTIEPVMKTSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSSREEEVASELHLSALLDMVDI Predict reactive species\nFull Name: minichromosome maintenance complex component 3 associated protein\nCalculated Molecular Weight: 218 kDa\nObserved Molecular Weight: 75-80 kDa\nGenBank Accession Number: BC013285\nGene Symbol: GANP\nGene ID (NCBI): 8888\nRRID: AB_2266280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869407465641,"sku":"11054-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11054-1-ap","provider":"Iright","version":"1.0","type":"link"}