{"product_id":"proteintech-11066-1-ap","title":"Proteintech, 11066-1-AP, ABCB9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCB9 (11066-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB9 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11066-1-AP targets ABCB9 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, HL-60 cells,  human testis tissue,  K-562 cells,  mouse thymus tissue\nPositive IP detected in: mouse thymus tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1542 Product name: Recombinant human ABCB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-181 aa of BC017348 Sequence: EDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWLLSTVRPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSYT Predict reactive species\nFull Name: ATP-binding cassette, sub-family B (MDR\/TAP), member 9\nCalculated Molecular Weight: 84 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC017348\nGene Symbol: ABCB9\nGene ID (NCBI): 23457\nRRID: AB_10898357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP78\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629763753,"sku":"11066-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11066-1-ap","provider":"Iright","version":"1.0","type":"link"}