{"product_id":"proteintech-11069-2-ap","title":"Proteintech, 11069-2-AP, FMR1NB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FMR1NB (11069-2-AP) by Proteintech is a Polyclonal antibody targeting FMR1NB in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11069-2-AP targets FMR1NB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  A549 cells,  MCF-7 cells,  SKOV-3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1531 Product name: Recombinant human FMR1NB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-186 aa of BC034320 Sequence: CSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQ Predict reactive species\nFull Name: fragile X mental retardation 1 neighbor\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC034320\nGene Symbol: FMR1NB\nGene ID (NCBI): 158521\nRRID: AB_2105567\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0W7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887641940137,"sku":"11069-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11069-2-ap","provider":"Iright","version":"1.0","type":"link"}