{"product_id":"proteintech-11076-1-ap","title":"Proteintech, 11076-1-AP, Oligophrenin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Oligophrenin 1 (11076-1-AP) by Proteintech is a Polyclonal antibody targeting Oligophrenin 1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11076-1-AP targets Oligophrenin 1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human cerebellum tissue, human retinoblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe OPHN1 gene encodes a Rho-GTPase activating protein (RhoGAP), and mutations in OPHN1 are responsible for non-specific X-linked mental retardation (NSMR).  OPHN1 is highly expressed in the brain and present both pre- and postsynaptically in neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1536 Product name: Recombinant human OPHN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-722 aa of BC059393 Sequence: DSSQCASIPYNGQGYPEPYVPEGGAYLPDREPFIVPVEPERTAEYEDDYGADEPEQQHPDHRRWRRALRPGPG Predict reactive species\nFull Name: oligophrenin 1\nCalculated Molecular Weight: 802 aa, 92 kDa\nObserved Molecular Weight: 92 kDa\nGenBank Accession Number: BC059393\nGene Symbol: Oligophrenin 1\nGene ID (NCBI): 4983\nRRID: AB_2158306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60890\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420441769,"sku":"11076-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11076-1-ap","provider":"Iright","version":"1.0","type":"link"}