{"product_id":"proteintech-11079-1-ap","title":"Proteintech, 11079-1-AP, IL-32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-32 (11079-1-AP) by Proteintech is a Polyclonal antibody targeting IL-32 in IHC, ELISA applications with reactivity to human samples\n11079-1-AP targets IL-32 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 32 (IL32) is a member of the cytokine family. IL32 contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. IL32 is a predominantly intracellular proinflammatory cytokine produced by epithelial cells, monocytes, T-lymphocytes and natural killer cells, and is involved in inflammation and cancer development. IL32 is able to induce the release a variety of pro-inflammatory cytokines such as IL8, tumor necrosis factor-α (TNFα) and IL6. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1484 Product name: Recombinant human IL-32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC009401 Sequence: MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK Predict reactive species\nFull Name: interleukin 32\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: BC009401\nGene Symbol: IL-32\nGene ID (NCBI): 9235\nRRID: AB_2877745\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24001\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868912537769,"sku":"11079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11079-1-ap","provider":"Iright","version":"1.0","type":"link"}