{"product_id":"proteintech-11080-1-ap","title":"Proteintech, 11080-1-AP, UBE2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2A (11080-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2A in WB, IHC, ELISA applications with reactivity to human samples\n11080-1-AP targets UBE2A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  COLO 320 cells,  human kidney tissue,  human placenta tissue\nPositive IHC detected in: human nasopharyngeal carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2A(Ubiquitin-conjugating enzyme E2 A) serves as the cognate E2-conjugating enzyme. It plays a critical role in regulating TP53 protein levels under both normal and stress conditions. UBE2A, UBE2B regulates TP53 levels in a \"yin-yang\" manner through a combination of two distinct mechanisms in mammalian cells(PMID:22083959). This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1567 Product name: Recombinant human UBE2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-152 aa of BC010175 Sequence: AGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2A (RAD6 homolog)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC010175\nGene Symbol: UBE2A\nGene ID (NCBI): 7319\nRRID: AB_2212040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49459\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869506982057,"sku":"11080-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11080-1-ap","provider":"Iright","version":"1.0","type":"link"}