{"product_id":"proteintech-11086-2-ap","title":"Proteintech, 11086-2-AP, NME1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NME1 (11086-2-AP) by Proteintech is a Polyclonal antibody targeting NME1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n11086-2-AP targets NME1 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  multi-cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human liver tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination.It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1548 Product name: Recombinant human NME1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC018994 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE Predict reactive species\nFull Name: non-metastatic cells 1, protein (NM23A) expressed in\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC018994\nGene Symbol: NME1\nGene ID (NCBI): 4830\nRRID: AB_2152689\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913356969,"sku":"11086-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11086-2-ap","provider":"Iright","version":"1.0","type":"link"}