{"product_id":"proteintech-11101-1-ap","title":"Proteintech, 11101-1-AP, Rab23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Rab23 (11101-1-AP) by Proteintech is a Polyclonal antibody targeting Rab23 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11101-1-AP targets Rab23 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  HEK-293 cells,  human brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab23 is a novel member of large Rab small GTPase family. It plays important roles during embryonic development. The brain-enriched Rab23 is the only Rab protein that is known to have a distinct function during central nervous system development, playing an essential role as a negative regulator of the Sonic Hedgehog (Shh) pathway. RAB23 has recently been identified in mesangial cells (MCs), and could serve as a biomarker that indicates the severity of FSGS ( focal segmental glomerulosclerosis). Mutations in RAB23 may result in ACPS2 ( acrocephalopolysyndactyly type 2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1588 Product name: Recombinant human RAB23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC015021 Sequence: MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSG Predict reactive species\nFull Name: RAB23, member RAS oncogene family\nCalculated Molecular Weight: 237 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC015021\nGene Symbol: RAB23\nGene ID (NCBI): 51715\nRRID: AB_2173784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULC3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899037353,"sku":"11101-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11101-1-ap","provider":"Iright","version":"1.0","type":"link"}