{"product_id":"proteintech-11103-1-ap","title":"Proteintech, 11103-1-AP, GATA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GATA2 (11103-1-AP) by Proteintech is a Polyclonal antibody targeting GATA2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11103-1-AP targets GATA2 in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse liver tissue,  K-562 cells,  mouse heart tissue,  rat heart tissue,  HEK-293 cells,  rat liver tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhat is the molecular weight of GATA2? Is GATA2 post-translationally modified?The molecular weight of GATA2 is 51 kDa. There are two known isoforms of GATA2 that use alternative first exons (PMID: 10731672). GATA2 can be phosphorylated, which regulates its activity (PMID: 7876160).What is the subcellular localization of GATA2?GATA2 acts as a transcription factor in the nucleus. However, it can also be found in the cytoplasm (PMID: 25163535) and its phosphorylation promotes nuclear localization (PMID: 15837948).What is the tissue expression pattern of GATA2?GATA2 was initially identified as a hematopoietic transcription factor regulating the differentiation of hematopoietic stem cells but is also present in early erythroid cells, mast cells, and megakaryocytes. Additionally, it is expressed in the central nervous system (PMID: 10357893).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG Predict reactive species\nFull Name: GATA binding protein 2\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC018988\nGene Symbol: GATA2\nGene ID (NCBI): 2624\nENSEMBL Gene ID: ENSG00000179348\nRRID: AB_10914503\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23769\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881866921,"sku":"11103-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11103-1-ap","provider":"Iright","version":"1.0","type":"link"}