{"product_id":"proteintech-11105-1-ap","title":"Proteintech, 11105-1-AP, STK38 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK38 (11105-1-AP) by Proteintech is a Polyclonal antibody targeting STK38 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n11105-1-AP targets STK38 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine\/threonine-protein kinase 38 belongs to AGC Ser\/Thr protein kinase family.STK38 implicates in cell proliferation and\/or tumor progression, and might play a role in the HIV-1 life cycle.Researches showed that STK38 with STK38L, were proapoptotic kinases and key members of the RASSF1\/STK4 signaling cascade and its kinase activity increased in early mitotic phase and was dependent on FRY and STK3.This antibody recognizes the C-terminal of STK38.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1559 Product name: Recombinant human STK38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-465 aa of BC012085 Sequence: AMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK Predict reactive species\nFull Name: serine\/threonine kinase 38\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC012085\nGene Symbol: STK38\nGene ID (NCBI): 11329\nRRID: AB_2196792\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15208\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869773385897,"sku":"11105-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11105-1-ap","provider":"Iright","version":"1.0","type":"link"}