{"product_id":"proteintech-11115-1-ap","title":"Proteintech, 11115-1-AP, DDX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX3 (11115-1-AP) by Proteintech is a Polyclonal antibody targeting DDX3 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11115-1-AP targets DDX3 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse brain tissue,  mouse liver tissue,  K-562 cells,  C6 cells,  PC-12 cells,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human malignant melanoma tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3\/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1614 Product name: Recombinant human DDX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 312-662 aa of BC011819 Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked\nCalculated Molecular Weight: 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC011819\nGene Symbol: DDX3\nGene ID (NCBI): 1654\nRRID: AB_10896499\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00571\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855095465,"sku":"11115-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11115-1-ap","provider":"Iright","version":"1.0","type":"link"}