{"product_id":"proteintech-11151-1-ap","title":"Proteintech, 11151-1-AP, MYEOV Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYEOV (11151-1-AP) by Proteintech is a Polyclonal antibody targeting MYEOV in WB, IHC, ELISA applications with reactivity to human samples\n11151-1-AP targets MYEOV in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells, Jurkat cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYEOV, also named as OCIM, was originally isolated by the application of the NIH\/3T3 tumorigenicity assay with DNA from a gastric carcinoma. It is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation. MYEOV is a candidate oncogene activated in the amplification core located proximal toCCND1. The observed MW of this protein is 55 kDa(PMID: 20854874 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1498 Product name: Recombinant human MYEOV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC011815 Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC Predict reactive species\nFull Name: myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC011815\nGene Symbol: MYEOV\nGene ID (NCBI): 26579\nRRID: AB_671520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869417459881,"sku":"11151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11151-1-ap","provider":"Iright","version":"1.0","type":"link"}