{"product_id":"proteintech-11155-1-ap","title":"Proteintech, 11155-1-AP, EIF5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF5 (11155-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11155-1-AP targets EIF5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEukaryotic translation initiation factor 5, also named as EIF5, is a 431 amino acid protein, which contains one W2 domain and belongs to the eIF-2-beta\/eIF-5 family. EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. EIF5 plays multiple roles in translation initiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, hamster, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1629 Product name: Recombinant human EIF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC032866 Sequence: MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNN Predict reactive species\nFull Name: eukaryotic translation initiation factor 5\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC032866\nGene Symbol: EIF5\nGene ID (NCBI): 1983\nRRID: AB_2877748\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980007081,"sku":"11155-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11155-1-ap","provider":"Iright","version":"1.0","type":"link"}