{"product_id":"proteintech-11156-1-ap","title":"Proteintech, 11156-1-AP, SMARCD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMARCD2 (11156-1-AP) by Proteintech is a Polyclonal antibody targeting SMARCD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11156-1-AP targets SMARCD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells,  RAW264.7 cells\nPositive IHC detected in: mouse spleen tissue, human cervical cancer tissue,  rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe SWI\/SNF chromatin remodelling complexes are important regulators of transcription; they consist of large multisubunit assemblies containing either Brm or Brg1 as the catalytic ATPase subunit and a variable subset of approximately 10 Brg\/Brm-associated factors (BAF) [PMID:20148946]. SMARCD2 is one of BAF60 proteins, which are found in most complexes, is thought to bridge interactions between transcription factors and SWI\/SNF complexes. [PMID:9427560]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1630 Product name: Recombinant human SMARCD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC018953 Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT Predict reactive species\nFull Name: SWI\/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC018953\nGene Symbol: SMARCD2\nGene ID (NCBI): 6603\nRRID: AB_2192145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887809515689,"sku":"11156-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11156-1-ap","provider":"Iright","version":"1.0","type":"link"}