{"product_id":"proteintech-11158-1-ap","title":"Proteintech, 11158-1-AP, ABCB7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCB7 (11158-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n11158-1-AP targets ABCB7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  mouse thymus tissue\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCB7 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCB7 exports glutathione-coordinated iron-sulfur clusters from the mitochondria to the cytosol in an ATP-dependent manner allowing the assembly of the cytosolic iron-sulfur-containing proteins and participates in iron homeostasis(PMID: 33157103, 17192393). ABCB7 structure and mutation causing X- linked sideroblastic anemia and ataxia (XLSA\/A) with disruption of cytosolic iron-sulfur protein maturation (PMID: 10196363,11050011).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1544 Product name: Recombinant human ABCB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-173 aa of BC006323 Sequence: AILIRPLVSVSGSGPQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMS Predict reactive species\nFull Name: ATP-binding cassette, sub-family B (MDR\/TAP), member 7\nCalculated Molecular Weight: 753 aa, 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC006323\nGene Symbol: ABCB7\nGene ID (NCBI): 22\nRRID: AB_2220945\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75027\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869441609897,"sku":"11158-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11158-1-ap","provider":"Iright","version":"1.0","type":"link"}